- MSP/MST1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-85330
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: RENFCRNPDG DSHGPWCYTM DPRTPFDYCA LRRCADDQPP
- PBS (pH 7.2) and 40% Glycerol
- MSP/MST1
- D3F15S2, DNF15S2, HGFL, MSP, NF15S2
- 0.1 ml (also 25ul)
- Human
- Rabbit
- macrophage stimulating 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Protein Kinase
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
RENFCRNPDGDSHGPWCYTMDPRTPFDYCALRRCADDQPP
Specifications/Features
Available conjugates: Unconjugated